FXYD1 antibody (70R-5227)

Rabbit polyclonal FXYD1 antibody

Synonyms Polyclonal FXYD1 antibody, Anti-FXYD1 antibody, Fsxyd 1 antibody, Fsxyd1, MGC44983 antibody, Fsxyd-1 antibody, PLM antibody, Phospholemman antibody, Fxyd Domain Containing Ion Transport Regulator 1 antibody, Fsxyd-1, Fsxyd 1
Cross Reactivity Human
Applications WB
Immunogen FXYD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILG
Assay Information FXYD1 Blocking Peptide, catalog no. 33R-1515, is also available for use as a blocking control in assays to test for specificity of this FXYD1 antibody


Western Blot analysis using FXYD1 antibody (70R-5227)

FXYD1 antibody (70R-5227) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 8 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FXYD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FXYD1 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FXYD1 antibody (70R-5227) | FXYD1 antibody (70R-5227) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors