FXYD5 antibody (70R-1682)

Rabbit polyclonal FXYD5 antibody raised against the N terminal of FXYD5

Synonyms Polyclonal FXYD5 antibody, Anti-FXYD5 antibody, Fsxyd-5, Fsxyd-5 antibody, Fxyd Domain Containing Ion Transport Regulator 5 antibody, Fsxyd 5, Fsxyd 5 antibody, Fsxyd5
Specificity FXYD5 antibody was raised against the N terminal of FXYD5
Cross Reactivity Human
Applications WB
Immunogen FXYD5 antibody was raised using the N terminal of FXYD5 corresponding to a region with amino acids LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD
Assay Information FXYD5 Blocking Peptide, catalog no. 33R-5326, is also available for use as a blocking control in assays to test for specificity of this FXYD5 antibody


Western Blot analysis using FXYD5 antibody (70R-1682)

FXYD5 antibody (70R-1682) used at 0.625 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FXYD5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.625 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIon Channel (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FXYD5 antibody (70R-1682) | FXYD5 antibody (70R-1682) used at 0.625 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors