FYN antibody (70R-5772)

Rabbit polyclonal FYN antibody raised against the N terminal of FYN

Synonyms Polyclonal FYN antibody, Anti-FYN antibody, SLK antibody, MGC45350 antibody, Fyn Oncogene Related To Src Fgr Yes antibody, SYN antibody
Specificity FYN antibody was raised against the N terminal of FYN
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FYN antibody was raised using the N terminal of FYN corresponding to a region with amino acids GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
Assay Information FYN Blocking Peptide, catalog no. 33R-3193, is also available for use as a blocking control in assays to test for specificity of this FYN antibody


Western blot analysis using FYN antibody (70R-5772)

Tissue analyzed: 293T; Antibody Dilution: 1.0ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FYN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using FYN antibody (70R-5772) | Tissue analyzed: 293T; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using FYN antibody (70R-5772) | Tissue analyzed: Human Adult Placenta; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using FYN antibody (70R-5772) | Recommended FYN Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using FYN antibody (70R-5772) | Tissue analyzed: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors