FYN antibody (70R-5867)

Rabbit polyclonal FYN antibody raised against the middle region of FYN

Synonyms Polyclonal FYN antibody, Anti-FYN antibody, SLK antibody, Fyn Oncogene Related To Src Fgr Yes antibody, SYN antibody, MGC45350 antibody
Specificity FYN antibody was raised against the middle region of FYN
Cross Reactivity Human
Applications WB
Immunogen FYN antibody was raised using the middle region of FYN corresponding to a region with amino acids CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN
Assay Information FYN Blocking Peptide, catalog no. 33R-1771, is also available for use as a blocking control in assays to test for specificity of this FYN antibody

Images

Western blot analysis using FYN antibody (70R-5867)

Recommended FYN Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FYN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using FYN antibody (70R-5867) | Recommended FYN Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors