FZD4 antibody (70R-7474)
Rabbit polyclonal FZD4 antibody
Overview
Overview
| Synonyms | Polyclonal FZD4 antibody, Anti-FZD4 antibody, MGC34390 antibody, EVR1 antibody, Fz-4 antibody, FZD4S antibody, FzE4 antibody, FEVR antibody, Frizzled Homolog 4 antibody, GPCR antibody, Frizzled family receptor 4, FEVR antibody, WNT receptor frizzled-4 antibody, CD344 antibody |
|---|---|
| Cross Reactivity | Human,Mouse,Rat |
| Applications | IHC, WB |
| Immunogen | FZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
| Assay Information | FZD4 Blocking Peptide, catalog no. 33R-3346, is also available for use as a blocking control in assays to test for specificity of this FZD4 antibody |
Images
Immunohistochemical staining using FZD4 antibody (70R-7474)
Immunohistochemical staining of human skin cells using 70R-7474
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 60 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product