FZD4 Blocking Peptide (33R-3346)
A synthetic peptide for use as a blocking control in assays to test for specificity of FZD4 antibody, catalog no. 70R-7474
Overview
Overview
| Synonyms | FZD4 control peptide, FZD4 antibody Blocking Peptide, Anti-FZD4 Blocking Peptide, Frizzled Homolog 4 Blocking Peptide, EVR1 Blocking Peptide, FEVR Blocking Peptide, FZD4S Blocking Peptide, Fz-4 Blocking Peptide, FzE4 Blocking Peptide, GPCR Blocking Peptide, MGC34390 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
|---|---|
| Molecular Weight | 60 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product