FZD4 Blocking Peptide (33R-3346)

A synthetic peptide for use as a blocking control in assays to test for specificity of FZD4 antibody, catalog no. 70R-7474

Synonyms FZD4 control peptide, FZD4 antibody Blocking Peptide, Anti-FZD4 Blocking Peptide, Frizzled Homolog 4 Blocking Peptide, EVR1 Blocking Peptide, FEVR Blocking Peptide, FZD4S Blocking Peptide, Fz-4 Blocking Peptide, FzE4 Blocking Peptide, GPCR Blocking Peptide, MGC34390 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
Molecular Weight 60 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors