GABRA3 antibody (70R-1528)

Rabbit polyclonal GABRA3 antibody

Synonyms Polyclonal GABRA3 antibody, Anti-GABRA3 antibody, Gamma-Aminobutyric Acid antibody, Gaba A Receptor Alpha 3 antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen GABRA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT
Assay Information GABRA3 Blocking Peptide, catalog no. 33R-1156, is also available for use as a blocking control in assays to test for specificity of this GABRA3 antibody


Western Blot analysis using GABRA3 antibody (70R-1528)

GABRA3 antibody (70R-1528) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GABRA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GABRA3 antibody (70R-1528) | GABRA3 antibody (70R-1528) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors