GABRG2 antibody (70R-1545)

Rabbit polyclonal GABRG2 antibody

Synonyms Polyclonal GABRG2 antibody, Anti-GABRG2 antibody, CAE2 antibody, Gamma-Aminobutyric Acid antibody, Gaba A Receptor Gamma 2 antibody, ECA2 antibody, GEFSP3 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR
Assay Information GABRG2 Blocking Peptide, catalog no. 33R-1384, is also available for use as a blocking control in assays to test for specificity of this GABRG2 antibody


Western Blot analysis using GABRG2 antibody (70R-1545)

GABRG2 antibody (70R-1545) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GABRG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the brain, mediates neuronal inhibition by binding to GABA receptors. The type A GABA receptors are pentameric chloride channels assembled from among many genetic variants of GABA(A) subunits. GABRG2 is the gamma 2 subunit of GABA(A) receptor. Mutations in this gene have been associated with epilepsy and febrile seizures.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GABRG2 antibody (70R-1545) | GABRG2 antibody (70R-1545) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors