Gabrp Blocking Peptide (33R-10330)

A synthetic peptide for use as a blocking control in assays to test for specificity of Gabrp antibody, catalog no. 70R-8071

Synonyms Gabrp control peptide, Gabrp antibody Blocking Peptide, Anti-Gabrp Blocking Peptide, gamma-aminobutyric acid, GABA A receptor, pi Blocking Peptide, MGC38123 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLR
Molecular Weight 50 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. In the uterus, the function of the receptor appears to be related to tissue contractility. The binding of this pI subunit with other GABA(A) receptor subunits alters the sensitivity of recombinant receptors to modulatory agents such as pregnanolone.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors