GABRQ antibody (70R-5214)

Rabbit polyclonal GABRQ antibody

Synonyms Polyclonal GABRQ antibody, Anti-GABRQ antibody, Gamma-Aminobutyric Acid antibody, Gaba Receptor Theta antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen GABRQ antibody was raised using a synthetic peptide corresponding to a region with amino acids KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGG
Assay Information GABRQ Blocking Peptide, catalog no. 33R-4370, is also available for use as a blocking control in assays to test for specificity of this GABRQ antibody


Western Blot analysis using GABRQ antibody (70R-5214)

GABRQ antibody (70R-5214) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABRQ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, theta subunit. GABRQ gene is mapped to chromosome Xq28 in a cluster including the genes encoding the alpha 3 and epsilon subunits of the same receptor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GABRQ antibody (70R-5214) | GABRQ antibody (70R-5214) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors