GALK1 Blocking Peptide (33R-10307)

A synthetic peptide for use as a blocking control in assays to test for specificity of GALK1 antibody, catalog no. 70R-10394

Synonyms GALK1 control peptide, GALK1 antibody Blocking Peptide, Anti-GALK1 Blocking Peptide, galactokinase 1 Blocking Peptide, GALK Blocking Peptide, GK1 Blocking Peptide, GALK1, GALK-1, GALK 1, GALK-1 Blocking Peptide, GALK 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARD
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors