GALNAC4S-6ST Blocking Peptide (33R-10074)
A synthetic peptide for use as a blocking control in assays to test for specificity of GALNAC4S-6ST antibody, catalog no. 70R-5944
Overview
Overview
| Synonyms | GALNAC4S-6ST control peptide, GALNAC4S-6ST antibody Blocking Peptide, Anti-GALNAC4S-6ST Blocking Peptide, B Cell Rag Associated Protein Blocking Peptide, BRAG Blocking Peptide, DKFZp781H1369 Blocking Peptide, KIAA0598 Blocking Peptide, MGC34346 Blocking Peptide, RP11-47G11.1 Blocking Peptide, GALNAC4S, GALNACS-4, GALNACS 4, GALNACS-4 Blocking Peptide, GALNACS 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS |
|---|---|
| Molecular Weight | 65 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product