GALNAC4S-6ST Blocking Peptide (33R-10074)

A synthetic peptide for use as a blocking control in assays to test for specificity of GALNAC4S-6ST antibody, catalog no. 70R-5944

Synonyms GALNAC4S-6ST control peptide, GALNAC4S-6ST antibody Blocking Peptide, Anti-GALNAC4S-6ST Blocking Peptide, B Cell Rag Associated Protein Blocking Peptide, BRAG Blocking Peptide, DKFZp781H1369 Blocking Peptide, KIAA0598 Blocking Peptide, MGC34346 Blocking Peptide, RP11-47G11.1 Blocking Peptide, GALNAC4S, GALNACS-4, GALNACS 4, GALNACS-4 Blocking Peptide, GALNACS 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
Molecular Weight 65 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors