GANC Blocking Peptide (33R-9658)
A synthetic peptide for use as a blocking control in assays to test for specificity of GANC antibody, catalog no. 70R-4273
Overview
Overview
| Synonyms | GANC control peptide, GANC antibody Blocking Peptide, Anti-GANC Blocking Peptide, Glucosidase Alpha; Neutral C Blocking Peptide, MGC138256 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR |
|---|---|
| Molecular Weight | 104 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product