GANC Blocking Peptide (33R-9658)

A synthetic peptide for use as a blocking control in assays to test for specificity of GANC antibody, catalog no. 70R-4273

Synonyms GANC control peptide, GANC antibody Blocking Peptide, Anti-GANC Blocking Peptide, Glucosidase Alpha; Neutral C Blocking Peptide, MGC138256 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR
Molecular Weight 104 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors