GAPDH antibody (70R-2033)

Rabbit polyclonal GAPDH antibody raised against the middle region of GAPDH

Synonyms Polyclonal GAPDH antibody, Anti-GAPDH antibody, Glyceraldehyde-3-Phosphate Dehydrogenase antibody, GAPD antibody, MGC88685 antibody, G3PD antibody
Specificity GAPDH antibody was raised against the middle region of GAPDH
Cross Reactivity Human
Applications WB
Immunogen GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
Assay Information GAPDH Blocking Peptide, catalog no. 33R-4241, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody


Western Blot analysis using GAPDH antibody (70R-2033)

GAPDH antibody (70R-2033) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GAPDH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GAPDH antibody (70R-2033) | GAPDH antibody (70R-2033) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors