GAS8 Blocking Peptide (33R-7816)

A synthetic peptide for use as a blocking control in assays to test for specificity of GAS8 antibody, catalog no. 70R-4074

Synonyms GAS8 control peptide, GAS8 antibody Blocking Peptide, Anti-GAS8 Blocking Peptide, Growth Arrest-Specific 8 Blocking Peptide, GAS11 Blocking Peptide, MGC138326 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK
Molecular Weight 56 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors