GAS8 Blocking Peptide (33R-9820)
A synthetic peptide for use as a blocking control in assays to test for specificity of GAS8 antibody, catalog no. 70R-3968
Overview
Overview
| Synonyms | GAS8 control peptide, GAS8 antibody Blocking Peptide, Anti-GAS8 Blocking Peptide, Growth Arrest-Specific 8 Blocking Peptide, GAS11 Blocking Peptide, MGC138326 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM |
|---|---|
| Molecular Weight | 56 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product