GBA Blocking Peptide (33R-10317)

A synthetic peptide for use as a blocking control in assays to test for specificity of GBA antibody, catalog no. 70R-10294

Synonyms GBA control peptide, GBA antibody Blocking Peptide, Anti-GBA Blocking Peptide, glucosidase, beta, acid Blocking Peptide, GBA1 Blocking Peptide, GCB Blocking Peptide, GLUC Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues EGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVG
Molecular Weight 59 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors