GBP4 antibody (70R-1952)

Rabbit polyclonal GBP4 antibody raised against the middle region of GBP4

Synonyms Polyclonal GBP4 antibody, Anti-GBP4 antibody, Guanylate Binding Protein 4 antibody, Mpa2 antibody
Specificity GBP4 antibody was raised against the middle region of GBP4
Cross Reactivity Human
Applications WB
Immunogen GBP4 antibody was raised using the middle region of GBP4 corresponding to a region with amino acids NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERE
Assay Information GBP4 Blocking Peptide, catalog no. 33R-6647, is also available for use as a blocking control in assays to test for specificity of this GBP4 antibody


Western Blot analysis using GBP4 antibody (70R-1952)

GBP4 antibody (70R-1952) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GBP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GBP4 belongs to the GBP family. It binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. GBP4 plays a role in erythroid differentiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GBP4 antibody (70R-1952) | GBP4 antibody (70R-1952) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors