GBP4 antibody (70R-1952)
Rabbit polyclonal GBP4 antibody raised against the middle region of GBP4
Overview
Overview
Synonyms | Polyclonal GBP4 antibody, Anti-GBP4 antibody, Guanylate Binding Protein 4 antibody, Mpa2 antibody |
---|---|
Specificity | GBP4 antibody was raised against the middle region of GBP4 |
Cross Reactivity | Human |
Applications | WB |
Immunogen | GBP4 antibody was raised using the middle region of GBP4 corresponding to a region with amino acids NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERE |
Assay Information | GBP4 Blocking Peptide, catalog no. 33R-6647, is also available for use as a blocking control in assays to test for specificity of this GBP4 antibody |
Images
Western Blot analysis using GBP4 antibody (70R-1952)
GBP4 antibody (70R-1952) used at 1 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 45 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GBP4 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | GBP4 belongs to the GBP family. It binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. GBP4 plays a role in erythroid differentiation. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product