GC Blocking Peptide (33R-10350)

A synthetic peptide for use as a blocking control in assays to test for specificity of GC antibody, catalog no. 70R-10252

Synonyms GC control peptide, GC antibody Blocking Peptide, Anti-GC Blocking Peptide, group-specific component, vitamin D binding protein Blocking Peptide, DBP Blocking Peptide, DBP/GC Blocking Peptide, GRD3 Blocking Peptide, VDBG Blocking Peptide, VDBP Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNS
Molecular Weight 54 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors