GC Blocking Peptide (33R-10350)
A synthetic peptide for use as a blocking control in assays to test for specificity of GC antibody, catalog no. 70R-10252
Overview
Overview
| Synonyms | GC control peptide, GC antibody Blocking Peptide, Anti-GC Blocking Peptide, group-specific component, vitamin D binding protein Blocking Peptide, DBP Blocking Peptide, DBP/GC Blocking Peptide, GRD3 Blocking Peptide, VDBG Blocking Peptide, VDBP Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | KFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNS |
|---|---|
| Molecular Weight | 54 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product