GCET2 antibody (70R-2354)

Rabbit polyclonal GCET2 antibody raised against the middle region of GCET2

Synonyms Polyclonal GCET2 antibody, Anti-GCET2 antibody, MGC40441 antibody, Germinal Center Expressed Transcript 2 antibody, GCAT2 antibody, HGAL antibody
Specificity GCET2 antibody was raised against the middle region of GCET2
Cross Reactivity Human
Applications WB
Immunogen GCET2 antibody was raised using the middle region of GCET2 corresponding to a region with amino acids YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH
Assay Information GCET2 Blocking Peptide, catalog no. 33R-10243, is also available for use as a blocking control in assays to test for specificity of this GCET2 antibody


Western Blot analysis using GCET2 antibody (70R-2354)

GCET2 antibody (70R-2354) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GCET2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GCET2 is a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GCET2 antibody (70R-2354) | GCET2 antibody (70R-2354) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors