GCET2 Blocking Peptide (33R-10243)
A synthetic peptide for use as a blocking control in assays to test for specificity of GCET2 antibody, catalog no. 70R-2354
Overview
Overview
| Synonyms | GCET2 control peptide, GCET2 antibody Blocking Peptide, Anti-GCET2 Blocking Peptide, Germinal Center Expressed Transcript 2 Blocking Peptide, GCAT2 Blocking Peptide, HGAL Blocking Peptide, MGC40441 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH |
|---|---|
| Molecular Weight | 21 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | GCET2 is a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product