GCET2 Blocking Peptide (33R-10243)

A synthetic peptide for use as a blocking control in assays to test for specificity of GCET2 antibody, catalog no. 70R-2354

Synonyms GCET2 control peptide, GCET2 antibody Blocking Peptide, Anti-GCET2 Blocking Peptide, Germinal Center Expressed Transcript 2 Blocking Peptide, GCAT2 Blocking Peptide, HGAL Blocking Peptide, MGC40441 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH
Molecular Weight 21 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GCET2 is a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors