GCHFR antibody (70R-2593)

Rabbit polyclonal GCHFR antibody raised against the N terminal of GCHFR

Synonyms Polyclonal GCHFR antibody, Anti-GCHFR antibody, HsT16933 antibody, MGC138469 antibody, MGC138467 antibody, P35 antibody, GFRP antibody, Gtp Cyclohydrolase I Feedback Regulator antibody
Specificity GCHFR antibody was raised against the N terminal of GCHFR
Cross Reactivity Human
Applications WB
Immunogen GCHFR antibody was raised using the N terminal of GCHFR corresponding to a region with amino acids MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD
Assay Information GCHFR Blocking Peptide, catalog no. 33R-6313, is also available for use as a blocking control in assays to test for specificity of this GCHFR antibody


Western Blot analysis using GCHFR antibody (70R-2593)

GCHFR antibody (70R-2593) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GCHFR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GCHFR antibody (70R-2593) | GCHFR antibody (70R-2593) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors