GCNT3 antibody (70R-1911)

Rabbit polyclonal GCNT3 antibody

Synonyms Polyclonal GCNT3 antibody, Anti-GCNT3 antibody, C2/4GnT antibody, Glucosaminyl antibody, N-Acetyl Transferase 3 Mucin Type antibody, GnT-M antibody, C2GnT-M antibody, C2GnT2 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
Assay Information GCNT3 Blocking Peptide, catalog no. 33R-1261, is also available for use as a blocking control in assays to test for specificity of this GCNT3 antibody


Immunohistochemical staining using GCNT3 antibody (70R-1911)

GCNT3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GCNT3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GCNT3 antibody (70R-1911) | GCNT3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using GCNT3 antibody (70R-1911) | GCNT3 antibody (70R-1911) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using GCNT3 antibody (70R-1911) | GCNT3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors