GFPT2 antibody (70R-3650)

Rabbit polyclonal GFPT2 antibody raised against the middle region of GFPT2

Synonyms Polyclonal GFPT2 antibody, Anti-GFPT2 antibody, GFPT 2 antibody, FLJ10380 antibody, GFPT 2, GFPT-2, Glutamine-Fructose-6-Phosphate Transaminase 2 antibody, GFAT2 antibody, GFPT-2 antibody, GFPT2
Specificity GFPT2 antibody was raised against the middle region of GFPT2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GFPT2 antibody was raised using the middle region of GFPT2 corresponding to a region with amino acids TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
Assay Information GFPT2 Blocking Peptide, catalog no. 33R-8983, is also available for use as a blocking control in assays to test for specificity of this GFPT2 antibody


Western Blot analysis using GFPT2 antibody (70R-3650)

GFPT2 antibody (70R-3650) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GFPT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GFPT2 antibody (70R-3650) | GFPT2 antibody (70R-3650) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors