GFRA2 antibody (70R-5332)

Rabbit polyclonal GFRA2 antibody raised against the C terminal of GFRA2

Synonyms Polyclonal GFRA2 antibody, Anti-GFRA2 antibody, TRNR2 antibody, GFRA-2, GDNFRB antibody, GFRA2, GFRA-2 antibody, Gdnf Family Receptor Alpha 2 antibody, NTNRA antibody, GFRA 2 antibody, NRTNR-ALPHA antibody, RETL2 antibody, GFRA 2
Specificity GFRA2 antibody was raised against the C terminal of GFRA2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GFRA2 antibody was raised using the C terminal of GFRA2 corresponding to a region with amino acids NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK
Assay Information GFRA2 Blocking Peptide, catalog no. 33R-6924, is also available for use as a blocking control in assays to test for specificity of this GFRA2 antibody

Images

Western Blot analysis using GFRA2 antibody (70R-5332)

GFRA2 antibody (70R-5332) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GFRA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. GFRA2 is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GFRA2 antibody (70R-5332) | GFRA2 antibody (70R-5332) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors