GFRA4 Blocking Peptide (33R-7458)
A synthetic peptide for use as a blocking control in assays to test for specificity of GFRA4 antibody, catalog no. 70R-10340
Overview
Overview
| Synonyms | GFRA4 control peptide, GFRA4 antibody Blocking Peptide, Anti-GFRA4 Blocking Peptide, GDNF family receptor alpha 4 Blocking Peptide, GFRA4, GFRA-4, GFRA 4, GFRA-4 Blocking Peptide, GFRA 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QAFASGWPPVLLDQLNPQGDPEHSLLQVSSTGRALERRSLLSILPVLALP |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for persephin, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for RET-associated diseases. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product