GFRA4 Blocking Peptide (33R-7458)

A synthetic peptide for use as a blocking control in assays to test for specificity of GFRA4 antibody, catalog no. 70R-10340

Synonyms GFRA4 control peptide, GFRA4 antibody Blocking Peptide, Anti-GFRA4 Blocking Peptide, GDNF family receptor alpha 4 Blocking Peptide, GFRA4, GFRA-4, GFRA 4, GFRA-4 Blocking Peptide, GFRA 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QAFASGWPPVLLDQLNPQGDPEHSLLQVSSTGRALERRSLLSILPVLALP
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for persephin, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for RET-associated diseases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors