GHR Blocking Peptide (33R-5341)
A synthetic peptide for use as a blocking control in assays to test for specificity of GHR antibody, catalog no. 70R-7290
Overview
Overview
| Synonyms | GHR control peptide, GHR antibody Blocking Peptide, Anti-GHR Blocking Peptide, Growth Hormone Receptor Blocking Peptide, GHBP Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF |
|---|---|
| Molecular Weight | 70 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | GHR is a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product