GIMAP1 antibody (70R-6386)

Rabbit polyclonal GIMAP1 antibody raised against the N terminal of GIMAP1

Synonyms Polyclonal GIMAP1 antibody, Anti-GIMAP1 antibody, IMAP38 antibody, GIMAP-1 antibody, GIMAP1, GIMAP 1 antibody, IMAP1 antibody, Gtpase Imap Family Member 1 antibody, GIMAP-1, HIMAP1 antibody, GIMAP 1
Specificity GIMAP1 antibody was raised against the N terminal of GIMAP1
Cross Reactivity Human
Applications WB
Immunogen GIMAP1 antibody was raised using the N terminal of GIMAP1 corresponding to a region with amino acids MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ
Assay Information GIMAP1 Blocking Peptide, catalog no. 33R-6034, is also available for use as a blocking control in assays to test for specificity of this GIMAP1 antibody

Images

Western Blot analysis using GIMAP1 antibody (70R-6386)

GIMAP1 antibody (70R-6386) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GIMAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GIMAP1 belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GIMAP1 antibody (70R-6386) | GIMAP1 antibody (70R-6386) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors