GJB1 antibody (70R-1684)

Rabbit polyclonal GJB1 antibody raised against the C terminal of GJB1

Synonyms Polyclonal GJB1 antibody, Anti-GJB1 antibody, GJB-1, GJB 1 antibody, Gap Junction Protein Beta 1 32Kda antibody, GJB1, GJB 1, GJB-1 antibody
Specificity GJB1 antibody was raised against the C terminal of GJB1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
Assay Information GJB1 Blocking Peptide, catalog no. 33R-3256, is also available for use as a blocking control in assays to test for specificity of this GJB1 antibody


Immunohistochemical staining using GJB1 antibody (70R-1684)

GJB1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (lndicated with Arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GJB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GJB1 antibody (70R-1684) | GJB1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (lndicated with Arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using GJB1 antibody (70R-1684) | GJB1 antibody (70R-1684) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors