GJB2 antibody (70R-1685)

Rabbit polyclonal GJB2 antibody raised against the N terminal of GJB2

Synonyms Polyclonal GJB2 antibody, Anti-GJB2 antibody, GJB-2 antibody, GJB 2 antibody, Gap Junction Protein Beta 2 26Kda antibody, GJB2, GJB 2, GJB-2
Specificity GJB2 antibody was raised against the N terminal of GJB2
Cross Reactivity Human, Dog
Applications WB
Immunogen GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
Assay Information GJB2 Blocking Peptide, catalog no. 33R-8880, is also available for use as a blocking control in assays to test for specificity of this GJB2 antibody


Western Blot analysis using GJB2 antibody (70R-1685)

GJB2 antibody (70R-1685) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GJB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 is designated alpha-1 gap junction protein, whereas CX32 and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GJB2 antibody (70R-1685) | GJB2 antibody (70R-1685) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors