GJC1 antibody (70R-1696)

Rabbit polyclonal GJC1 antibody raised against the N terminal of GJC1

Synonyms Polyclonal GJC1 antibody, Anti-GJC1 antibody, GJC-1, GJC 1, GJC1, Gap Junction Protein Chi 1 31.9Kda antibody, GJC 1 antibody, GJC-1 antibody
Specificity GJC1 antibody was raised against the N terminal of GJC1
Cross Reactivity Human,Rat
Applications WB
Immunogen GJC1 antibody was raised using the N terminal of GJC1 corresponding to a region with amino acids IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF
Assay Information GJC1 Blocking Peptide, catalog no. 33R-3961, is also available for use as a blocking control in assays to test for specificity of this GJC1 antibody


Western Blot analysis using GJC1 antibody (70R-1696)

GJC1 antibody (70R-1696) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GJC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CX31.9 is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GJC1 antibody (70R-1696) | GJC1 antibody (70R-1696) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors