GJD3 Blocking Peptide (33R-10333)

A synthetic peptide for use as a blocking control in assays to test for specificity of GJD3 antibody, catalog no. 70R-8184

Synonyms GJD3 control peptide, GJD3 antibody Blocking Peptide, Anti-GJD3 Blocking Peptide, gap junction protein, delta 3, 31.9kDa Blocking Peptide, CX31.9 Blocking Peptide, Cx30.2 Blocking Peptide, GJA11 Blocking Peptide, GJC1 Blocking Peptide, GJD3, GJD-3, GJD 3, GJD-3 Blocking Peptide, GJD 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPP
Molecular Weight 32 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the large family of connexins that are required for the formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, on the cell surface. This connexon can interact with a connexon from a neighboring cell, thus forming a channel linking the cytoplasm of the 2 cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors