GJE1 antibody (70R-1698)

Rabbit polyclonal GJE1 antibody raised against the C terminal of GJE1

Synonyms Polyclonal GJE1 antibody, Anti-GJE1 antibody, GJE-1 antibody, GJE-1, GJE 1 antibody, Gap Junction Protein Epsilon 1 29Kda antibody, GJE 1, GJE1
Specificity GJE1 antibody was raised against the C terminal of GJE1
Cross Reactivity Human
Applications WB
Immunogen GJE1 antibody was raised using the C terminal of GJE1 corresponding to a region with amino acids KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
Assay Information GJE1 Blocking Peptide, catalog no. 33R-4739, is also available for use as a blocking control in assays to test for specificity of this GJE1 antibody


Western blot analysis using GJE1 antibody (70R-1698)

Recommended GJE1 Antibody Titration: 2.5ug/ml


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GJE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GJE1 is a protein component of GAP junction

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using GJE1 antibody (70R-1698) | Recommended GJE1 Antibody Titration: 2.5ug/ml

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors