GLIPR1L1 Blocking Peptide (33R-6798)
A synthetic peptide for use as a blocking control in assays to test for specificity of GLIPR1L1 antibody, catalog no. 70R-4567
Overview
Overview
| Synonyms | GLIPR1L1 control peptide, GLIPR1L1 antibody Blocking Peptide, Anti-GLIPR1L1 Blocking Peptide, Gli Pathogenesis-Related 1 Like 1 Blocking Peptide, ALKN2972 Blocking Peptide, MGC26856 Blocking Peptide, PRO7434 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | GLIPR1L1 is a novel testis-specific CAP protein and is presented to the acrosomal cap following in vitro capacitation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product