GLIPR1L1 Blocking Peptide (33R-6798)

A synthetic peptide for use as a blocking control in assays to test for specificity of GLIPR1L1 antibody, catalog no. 70R-4567

Synonyms GLIPR1L1 control peptide, GLIPR1L1 antibody Blocking Peptide, Anti-GLIPR1L1 Blocking Peptide, Gli Pathogenesis-Related 1 Like 1 Blocking Peptide, ALKN2972 Blocking Peptide, MGC26856 Blocking Peptide, PRO7434 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GLIPR1L1 is a novel testis-specific CAP protein and is presented to the acrosomal cap following in vitro capacitation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors