GLRX3 antibody (70R-4390)

Rabbit polyclonal GLRX3 antibody raised against the N terminal of GLRX3

Synonyms Polyclonal GLRX3 antibody, Anti-GLRX3 antibody, FLJ11864 antibody, TXNL3 antibody, GLRX-3 antibody, PICOT antibody, TXNL2 antibody, Glutaredoxin 3 antibody, GRX3 antibody, GLRX 3 antibody, GLRX4 antibody, bA500G10.4 antibody, GLRX3, GLRX 3, GRX4 antibody, GLRX-3
Specificity GLRX3 antibody was raised against the N terminal of GLRX3
Cross Reactivity Human
Applications WB
Immunogen GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
Assay Information GLRX3 Blocking Peptide, catalog no. 33R-5905, is also available for use as a blocking control in assays to test for specificity of this GLRX3 antibody

Images

Western Blot analysis using GLRX3 antibody (70R-4390)

GLRX3 antibody (70R-4390) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLRX3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GLRX3 may play a role in regulating the function of the thioredoxin system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLRX3 antibody (70R-4390) | GLRX3 antibody (70R-4390) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors