GLS antibody (70R-5477)

Rabbit polyclonal GLS antibody raised against the middle region of GLS

Synonyms Polyclonal GLS antibody, Anti-GLS antibody, FLJ10358 antibody, AAD20 antibody, Glutaminase antibody, GLS1 antibody, KIAA0838 antibody, DKFZp686O15119 antibody
Specificity GLS antibody was raised against the middle region of GLS
Cross Reactivity Human
Applications WB
Immunogen GLS antibody was raised using the middle region of GLS corresponding to a region with amino acids VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
Assay Information GLS Blocking Peptide, catalog no. 33R-9711, is also available for use as a blocking control in assays to test for specificity of this GLS antibody


Western Blot analysis using GLS antibody (70R-5477)

GLS antibody (70R-5477) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sahai demonstrated phosphate-activated glutaminase in human platelets. It is the major enzyme yielding glutamate from glutamine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GLS antibody (70R-5477) | GLS antibody (70R-5477) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors