GLS2 antibody (70R-1110)

Rabbit polyclonal GLS2 antibody

Synonyms Polyclonal GLS2 antibody, Anti-GLS2 antibody, LGA antibody, MGC71567 antibody, Glutaminase 2 antibody, GLS antibody, GA antibody, hLGA antibody
Cross Reactivity Human, Mouse, Rat
Applications IHC, WB
Immunogen GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
Assay Information GLS2 Blocking Peptide, catalog no. 33R-3113, is also available for use as a blocking control in assays to test for specificity of this GLS2 antibody

Images

Western Blot analysis using GLS2 antibody (70R-1110)

GLS2 antibody (70R-1110) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GLS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLS2 antibody (70R-1110) | GLS2 antibody (70R-1110) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using GLS2 antibody (70R-1110) | GLS2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors