Glucagon antibody (70R-1710)

Rabbit polyclonal Glucagon antibody raised against the N terminal of GCG

Synonyms Polyclonal Glucagon antibody, Anti-Glucagon antibody, GLP2 antibody, GRPP antibody, GCG antibody, GLP1 antibody
Specificity Glucagon antibody was raised against the N terminal of GCG
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen Glucagon antibody was raised using the N terminal of GCG corresponding to a region with amino acids LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK
Assay Information Glucagon Blocking Peptide, catalog no. 33R-5415, is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody


Western Blot analysis using Glucagon antibody (70R-1710)

Glucagon antibody (70R-1710) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Glucagon antibody is supplied as lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GCG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Secreted in the pancreas, Glucagon exerts the opposite influence to insulin, in that glucagon is responsible for raising blood glucose levels. Glucagon is released from the pancreas when blood sugar (glucose) levels become depleted. Glucagon causes the liver to convert stored glycogen into glucose, which is released into the bloodstream.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Glucagon antibody (70R-1710) | Glucagon antibody (70R-1710) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors