Glucagon Blocking Peptide (33R-5415)
A synthetic peptide for use as a blocking control in assays to test for specificity of GCG antibody, catalog no. 70R-1710
Overview
Overview
| Synonyms | Glucagon control peptide, Glucagon antibody Blocking Peptide, Anti-Glucagon Blocking Peptide, GLP1 Blocking Peptide, GLP2 Blocking Peptide, GRPP Blocking Peptide, GCG Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK |
|---|---|
| Molecular Weight | 20 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product