Glucagon Blocking Peptide (33R-5415)

A synthetic peptide for use as a blocking control in assays to test for specificity of GCG antibody, catalog no. 70R-1710

Synonyms Glucagon control peptide, Glucagon antibody Blocking Peptide, Anti-Glucagon Blocking Peptide, GLP1 Blocking Peptide, GLP2 Blocking Peptide, GRPP Blocking Peptide, GCG Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK
Molecular Weight 20 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors