Glucagon Blocking Peptide (33R-9829)
A synthetic peptide for use as a blocking control in assays to test for specificity of GCG antibody, catalog no. 70R-6207
Overview
Overview
| Synonyms | Glucagon control peptide, Glucagon antibody Blocking Peptide, Anti-Glucagon Blocking Peptide, GLP1 Blocking Peptide, GLP2 Blocking Peptide, GRPP Blocking Peptide, GCG Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN |
|---|---|
| Molecular Weight | 4 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product