GLUD1 antibody (70R-2596)

Rabbit polyclonal GLUD1 antibody raised against the N terminal of GLUD1

Synonyms Polyclonal GLUD1 antibody, Anti-GLUD1 antibody, GLUD1, GLUD antibody, GLUD 1 antibody, GDH1 antibody, Glutamate Dehydrogenase 1 antibody, MGC132003 antibody, GLUD 1, GLUD-1, GLUD-1 antibody, GDH antibody
Specificity GLUD1 antibody was raised against the N terminal of GLUD1
Cross Reactivity Human
Applications WB
Immunogen GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
Assay Information GLUD1 Blocking Peptide, catalog no. 33R-2427, is also available for use as a blocking control in assays to test for specificity of this GLUD1 antibody


Immunohistochemical staining using GLUD1 antibody (70R-2596)

GLUD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLUD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance L-glutamate dehydrogenase (EC has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GLUD1 antibody (70R-2596) | GLUD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using GLUD1 antibody (70R-2596) | GLUD1 antibody (70R-2596) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using GLUD1 antibody (70R-2596) | GLUD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors