GLYATL2 antibody (70R-2525)

Rabbit polyclonal GLYATL2 antibody raised against the middle region of GLYATL2

Synonyms Polyclonal GLYATL2 antibody, Anti-GLYATL2 antibody, MGC24009 antibody, BXMAS2-10 antibody, Glycine-N-Acyltransferase-Like 2 antibody, GATF-B antibody
Specificity GLYATL2 antibody was raised against the middle region of GLYATL2
Cross Reactivity Human
Applications WB
Immunogen GLYATL2 antibody was raised using the middle region of GLYATL2 corresponding to a region with amino acids LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK
Assay Information GLYATL2 Blocking Peptide, catalog no. 33R-4843, is also available for use as a blocking control in assays to test for specificity of this GLYATL2 antibody

Images

Western Blot analysis using GLYATL2 antibody (70R-2525)

GLYATL2 antibody (70R-2525) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLYATL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GLYATL2 belongs to the glycine N-acyltransferase family. GLYATL2 is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLYATL2 antibody (70R-2525) | GLYATL2 antibody (70R-2525) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors