Glycoprotein Ib antibody (70R-6193)

Rabbit polyclonal Glycoprotein Ib antibody

Synonyms Polyclonal Glycoprotein Ib antibody, Anti-Glycoprotein Ib antibody, MGC34595 antibody, GP1B antibody, CD42B antibody, GP1BA antibody, BSS antibody, CD42b-alpha antibody, Platelet Alpha Polypeptide antibody
Cross Reactivity Human
Applications WB
Immunogen Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Assay Information Glycoprotein Ib Blocking Peptide, catalog no. 33R-7939, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein Ib antibody

Images

Western Blot analysis using Glycoprotein Ib antibody (70R-6193)

Glycoprotein Ib antibody (70R-6193) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GP1BA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. GP1BA is the alpha subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Glycoprotein Ib antibody (70R-6193) | Glycoprotein Ib antibody (70R-6193) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
OR
Shipping
View Our Distributors