GM2A antibody (70R-3965)

Rabbit polyclonal GM2A antibody raised against the N terminal of GM2A

Synonyms Polyclonal GM2A antibody, Anti-GM2A antibody, Gm2 Ganglioside Activator antibody, GMA 2 antibody, GM2A, GMA 2, GMA-2 antibody, GMA-2, SAP-3 antibody
Specificity GM2A antibody was raised against the N terminal of GM2A
Cross Reactivity Human
Applications WB
Immunogen GM2A antibody was raised using the N terminal of GM2A corresponding to a region with amino acids SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL
Assay Information GM2A Blocking Peptide, catalog no. 33R-8939, is also available for use as a blocking control in assays to test for specificity of this GM2A antibody

Images

Western Blot analysis using GM2A antibody (70R-3965)

GM2A antibody (70R-3965) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GM2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GM2A antibody (70R-3965) | GM2A antibody (70R-3965) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors