GM2A Blocking Peptide (33R-6345)

A synthetic peptide for use as a blocking control in assays to test for specificity of GM2A antibody, catalog no. 70R-4098

Synonyms GM2A control peptide, GM2A antibody Blocking Peptide, Anti-GM2A Blocking Peptide, Gm2 Ganglioside Activator Blocking Peptide, SAP-3 Blocking Peptide, GM2A, GMA-2, GMA 2, GMA-2 Blocking Peptide, GMA 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS
Molecular Weight 18 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the gangliosid.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors