GM2A Blocking Peptide (33R-6345)
A synthetic peptide for use as a blocking control in assays to test for specificity of GM2A antibody, catalog no. 70R-4098
Overview
Overview
| Synonyms | GM2A control peptide, GM2A antibody Blocking Peptide, Anti-GM2A Blocking Peptide, Gm2 Ganglioside Activator Blocking Peptide, SAP-3 Blocking Peptide, GM2A, GMA-2, GMA 2, GMA-2 Blocking Peptide, GMA 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS |
|---|---|
| Molecular Weight | 18 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the gangliosid. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product