GMPR2 antibody (70R-1015)

Rabbit polyclonal GMPR2 antibody raised against the C terminal of GMPR2

Synonyms Polyclonal GMPR2 antibody, Anti-GMPR2 antibody, Guanosine Monophosphate Reductase 2 antibody, MGC830 antibody, MGC15084 antibody
Specificity GMPR2 antibody was raised against the C terminal of GMPR2
Cross Reactivity Human,Mouse
Applications WB
Immunogen GMPR2 antibody was raised using the C terminal of GMPR2 corresponding to a region with amino acids GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV
Assay Information GMPR2 Blocking Peptide, catalog no. 33R-3152, is also available for use as a blocking control in assays to test for specificity of this GMPR2 antibody

Images

Western Blot analysis using GMPR2 antibody (70R-1015)

GMPR2 antibody (70R-1015) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GMPR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GMPR2 catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. It plays a role in modulating cellular differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GMPR2 antibody (70R-1015) | GMPR2 antibody (70R-1015) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors