GMPS antibody (70R-2088)

Rabbit polyclonal GMPS antibody raised against the middle region of GMPS

Synonyms Polyclonal GMPS antibody, Anti-GMPS antibody, RNA guanine Monphosphate Synthetase antibody
Specificity GMPS antibody was raised against the middle region of GMPS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GMPS antibody was raised using the middle region of GMPS corresponding to a region with amino acids VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA
Assay Information GMPS Blocking Peptide, catalog no. 33R-9455, is also available for use as a blocking control in assays to test for specificity of this GMPS antibody

Images

Western Blot analysis using GMPS antibody (70R-2088)

GMPS antibody (70R-2088) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GMPS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GMPS antibody (70R-2088) | GMPS antibody (70R-2088) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €352.82
Size: 50 ug
OR
Shipping
View Our Distributors