GNA12 antibody (70R-3131)

Rabbit polyclonal GNA12 antibody

Synonyms Polyclonal GNA12 antibody, Anti-GNA12 antibody, RMP antibody, gep antibody, MGC104623 antibody, NNX3 antibody, RNA guanine Nucleotide Binding Protein antibody, G Protein Alpha 12 antibody, MGC99644 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GNA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF
Assay Information GNA12 Blocking Peptide, catalog no. 33R-9073, is also available for use as a blocking control in assays to test for specificity of this GNA12 antibody


Western Blot analysis using GNA12 antibody (70R-3131)

GNA12 antibody (70R-3131) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNA12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GNA12 antibody (70R-3131) | GNA12 antibody (70R-3131) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors