GNAI1 antibody (70R-2047)

Rabbit polyclonal GNAI1 antibody

Synonyms Polyclonal GNAI1 antibody, Anti-GNAI1 antibody, G Protein Alpha Inhibiting Activity Polypeptide 1 antibody, Gi antibody, RNA guanine Nucleotide Binding Protein antibody
Cross Reactivity Human,Mouse,Rat,Drosophila
Applications WB
Immunogen GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
Assay Information GNAI1 Blocking Peptide, catalog no. 33R-10215, is also available for use as a blocking control in assays to test for specificity of this GNAI1 antibody

Western Blot analysis using GNAI1 antibody (70R-2047)

GNAI1 antibody (70R-2047) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNAI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1); and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using GNAI1 antibody (70R-2047) | GNAI1 antibody (70R-2047) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors