GNAL antibody (70R-2045)

Rabbit polyclonal GNAL antibody

Synonyms Polyclonal GNAL antibody, Anti-GNAL antibody, G Protein Alpha Activating Activity Polypeptide Olfactory Type antibody, RNA guanine Nucleotide Binding Protein antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GNAL antibody was raised using a synthetic peptide corresponding to a region with amino acids AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR
Assay Information GNAL Blocking Peptide, catalog no. 33R-1134, is also available for use as a blocking control in assays to test for specificity of this GNAL antibody


Western Blot analysis using GNAL antibody (70R-2045)

GNAL antibody (70R-2045) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNAL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GNAL antibody (70R-2045) | GNAL antibody (70R-2045) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors